PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 487412
Common NameARALYDRAFT_487412
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 520aa    MW: 58094 Da    PI: 6.091
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
487412genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-173481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed++l+d+v+++G g+W+++ r+ g+ R++k+c++rw ++l
           487412 34 KGPWSSAEDDILIDYVNKHGEGNWNAVQRHTGLFRCGKSCRLRWANHL 81
                     79******************************************9986 PP

2Myb_DNA-binding52.31.3e-1687130146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l++++++++G++ W++ a++++ gRt++++k++w++
           487412  87 KGAFSQEEEQLILELHAKMGNR-WARMAAHLP-GRTDNEIKNYWNT 130
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016933.4E-2801519IPR016310Transcription factor, GAMYB
PROSITE profilePS5129415.4062981IPR017930Myb domain
SuperFamilySSF466897.11E-3032128IPR009057Homeodomain-like
SMARTSM007178.4E-153383IPR001005SANT/Myb domain
PfamPF002493.2E-153481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-233588IPR009057Homeodomain-like
CDDcd001671.91E-113681No hitNo description
PROSITE profilePS5129426.22282136IPR017930Myb domain
SMARTSM007172.4E-1786134IPR001005SANT/Myb domain
PfamPF002491.2E-1587130IPR001005SANT/Myb domain
CDDcd001671.15E-1289130No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2589135IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MSYTSTDSDH NESPVADDNG SDCRSRWEGH ALKKGPWSSA EDDILIDYVN KHGEGNWNAV  60
QRHTGLFRCG KSCRLRWANH LRPNLKKGAF SQEEEQLILE LHAKMGNRWA RMAAHLPGRT  120
DNEIKNYWNT RIKRRQRAGL PLYPPEMHVE ALDWSQEYAK SRVMGEDGRH QDFLQLGSCE  180
SNFFFDSLNF TDMVPGAFDL ADMTAYKNLG NGASSPRYEN FMTPIMPSSK RLWESELLYP  240
GCSSTVKQEF LSPEQFQNTS PQKISKTCSF SVPCDVEHPL YGNRHSPIMI SDSHTPTDGI  300
VPSSKPSYGA VKLELPSFQY SETTFDQWKK SSSPPHSHLL DPFDTYIQSP PPPTGREESD  360
LYSSFDTGLL DMLLLEAKIR NNTTKNNLYK SCASTIPSAD LGKVTVSQTK SEDFDNSLKS  420
LVHSDMSTQN ADGIPPRQRE KKRKPLLDIT RPDVLLASSW LDHGLGIVKE TGSMSDALTV  480
LLGDDIGNDY MNMSVGASSG VGSCSWSNMP PVCQMTELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-31121352127MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1435443PRQREKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4119690.0AF411969.1 Arabidopsis thaliana putative transcription factor MYB33 (MYB33) mRNA, complete cds.
GenBankAK1189370.0AK118937.1 Arabidopsis thaliana At5g06100 mRNA for putative transcription factor MYB33, complete cds, clone: RAFL21-27-I01.
GenBankAY5196160.0AY519616.1 Arabidopsis thaliana MYB transcription factor (At5g06100) mRNA, complete cds.
GenBankBT0060490.0BT006049.1 Arabidopsis thaliana clone U51311 putative MYB family transcription factor (At5g06100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871198.10.0ATMYB33/MYB33
TrEMBLD7LZ380.0D7LZ38_ARALL; ATMYB33/MYB33
STRINGfgenesh2_kg.6__546__AT5G06100.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33